General Information

    • DRAMP ID

    • DRAMP00970

    • Peptide Name

    • Beta-hordothionin (beta-HT; Plant defensin)

    • Source

    • Hordeum vulgare (Barley)

    • Family

    • Belongs to the thionin family

    • Gene

    • THI1.2

    • Sequence

    • KSCCRSTLGRNCYNLCRVRGAQKLCANACRCKLTSGLKCPSSFPK

    • Sequence Length

    • 45

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00970 helical wheel diagram

    • PDB ID

    • 1WUW resolved by X-ray.

    • Predicted Structure

    • There is no predicted structure for DRAMP00970.

Physicochemical Information

    • Formula

    • C202H347N69O58S8

    • Absent Amino Acids

    • DEHIMW

    • Common Amino Acids

    • C

    • Mass

    • 4926.88

    • PI

    • 9.75

    • Basic Residues

    • 10

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +10

    • Boman Index

    • -99.98

    • Hydrophobicity

    • -0.349

    • Aliphatic Index

    • 56.44

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 1990

    • Absorbance 280nm

    • 45.23

    • Polar Residues

    • 22

DRAMP00970

DRAMP00970 chydropathy plot

Comments Information

    • Function

    • Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane.

Literature Information

  • ·Literature 1

    • Title

    • Crystal structure of alpha-hordothionin at 1.9 Angstrom resolution.

    • Reference

    • FEBS Lett. 2005 Apr 25;579(11):2301-2306.

    • Author

    • Johnson KA, Kim E, Teeter MM, Suh SW, Stec B.