General Information

    • DRAMP ID

    • DRAMP00971

    • Peptide Name

    • Probable thionin-2.3 (Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the thionin family

    • Gene

    • At2g15010

    • Sequence

    • QKTCCPSQSTRKEFEDCISEGNLQILCSAESGCRDTYVGYCPSGFPY

    • Sequence Length

    • 47

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Cytotoxic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00971 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00971.

Physicochemical Information

    • Formula

    • C219H335N59O76S6

    • Absent Amino Acids

    • HMW

    • Common Amino Acids

    • CS

    • Mass

    • 5202.78

    • PI

    • 4.66

    • Basic Residues

    • 4

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 8

    • Net Charge

    • -2

    • Boman Index

    • -94.48

    • Hydrophobicity

    • -0.549

    • Aliphatic Index

    • 41.49

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 105.33

    • Polar Residues

    • 23

DRAMP00971

DRAMP00971 chydropathy plot

Comments Information

    • Function

    • Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane.

    • PTM

    • Problely contains three disulfide bonds 5-41; 5-33; 17-27.

Literature Information

  • ·Literature 1

    • Title

    • Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana.

    • Reference

    • Nature. 1999 Dec 16;402(6763):761-768.

    • Author

    • Lin X, Kaul S, Rounsley S, Shea TP, et al.
  • ·Literature 2

    • Title

    • Empirical analysis of transcriptional activity in the Arabidopsis genome.

    • Reference

    • Science. 2003 Oct 31;302(5646):842-846.

    • Author

    • Yamada K, Lim J, Dale JM, Chen H, et al.