General Information

    • DRAMP ID

    • DRAMP00972

    • Peptide Name

    • Probable thionin-2.4 (Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Uncertain

    • Gene

    • At1g66100

    • Sequence

    • NICCPSIQARTFYNACLFAVGSPSSCIRNSSCLDISESTCPRGYTN

    • Sequence Length

    • 46

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Cytotoxic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00972 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00972.

Physicochemical Information

    • Formula

    • C207H326N60O69S6

    • Absent Amino Acids

    • HKMW

    • Common Amino Acids

    • S

    • Mass

    • 4951.59

    • PI

    • 7.77

    • Basic Residues

    • 3

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +1

    • Boman Index

    • -73.07

    • Hydrophobicity

    • 0.024

    • Aliphatic Index

    • 63.7

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 74.56

    • Polar Residues

    • 25

DRAMP00972

DRAMP00972 chydropathy plot

Comments Information

    • Function

    • Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane.

    • PTM

    • Contains four disulfide bonds 3-40;4-32;16-26.

Literature Information

  • ·Literature 1

    • Title

    • Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.

    • Reference

    • Nature. 2000 Dec 14;408(6814):816-820.

    • Author

    • Theologis A, Ecker JR, Palm CJ, et al.
  • ·Literature 2

    • Title

    • Empirical analysis of transcriptional activity in the Arabidopsis genome.

    • Reference

    • Science. 2003 Oct 31;302(5646):842-846.

    • Author

    • Yamada K, Lim J, Dale JM, et al.