General Information

    • DRAMP ID

    • DRAMP00975

    • Peptide Name

    • SI alpha-2 (SIa2; Plant defensin)

    • Source

    • Sorghum bicolor (Seeds)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • RVCMKGSAGFKGLCMRDQNCAQVCLQEGWGGGNCDGVMRQCKCIRQC

    • Sequence Length

    • 47

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00975 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00975.

Physicochemical Information

    • Formula

    • C205H340N70O62S11

    • Absent Amino Acids

    • HPTY

    • Common Amino Acids

    • CG

    • Mass

    • 5130.05

    • PI

    • 8.75

    • Basic Residues

    • 7

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +4

    • Boman Index

    • -84.34

    • Hydrophobicity

    • -0.272

    • Aliphatic Index

    • 47.66

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6000

    • Absorbance 280nm

    • 130.43

    • Polar Residues

    • 19

DRAMP00975

DRAMP00975 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • A new family of small (5 kDa) protein inhibitors of insect alpha-amylases from seeds or sorghum (Sorghum bicolar (L) Moench) have sequence homologies with wheat gamma-purothionins.

    • Reference

    • FEBS Lett. 1991 Feb 11;279(1):101-104.

    • Author

    • Bloch C Jr, Richardson M.