• DRAMP ID

    • DRAMP00975
    • Peptide Name

    • SI alpha-2 (SIa2; Plant defensin)
    • Source

    • Sorghum bicolor (Seeds)
    • Family

    • N/A
    • Gene

    • N/A
    • Sequence

    • RVCMKGSAGFKGLCMRDQNCAQVCLQEGWGGGNCDGVMRQCKCIRQC
    • Sequence Length

    • 47
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • N/A
    • Biological Activity

    • Antifungal, Antimicrobial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic Activity

      • N/A
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • N/A
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Other Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • N/A
    • DRAMP00975 helical wheel diagram
    • Formula

    • C205H340N70O62S11
    • Absent Amino Acids

    • HPTY
    • Common Amino Acids

    • CG
    • Mass

    • 5950.78
    • PI

    • 8.41
    • Basic Residues

    • 7
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 10
    • Boman Index

    • -84.34
    • Hydrophobicity

    • -27.23
    • Aliphatic Index

    • 47.66
    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 6000
    • Absorbance 280nm

    • 130.43
    • Polar Residues

    • 19

DRAMP00975

DRAMP00975 chydropathy plot
    • No comments found on DRAMP database

  • Literature 1
    • Title

    • A new family of small (5 kDa) protein inhibitors of insect alpha-amylases from seeds or sorghum (Sorghum bicolar (L) Moench) have sequence homologies with wheat gamma-purothionins.
    • Reference

    • FEBS Lett. 1991 Feb 11;279(1):101-104.
    • Author

    • Bloch C Jr, Richardson M.