• DRAMP ID

    • DRAMP00984
    • Peptide Name

    • Antimicrobial peptide Ar-AMP (Ar-AMP; hevin-like peptides; Plant defensin)
    • Source

    • Amaranthus retroflexus (Redroot amaranth) (Redroot pigweed)
    • Family

    • Belongs to the hevein-like family
    • Gene

    • N/A
    • Sequence

    • AGECVQGRCPSGMCCSQFGYCGRGPKYCGR
    • Sequence Length

    • 30
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial, Antifungal, Anti-Gram+, Antimicrobial
    • Target Organism

      • Fungi: Botrytis cinerea, Fusarium culmorum, Helminthosporium sativum and Alternaria consortiale.
      • Gram-positive bacterium: Bacillus subtilis.
    • Hemolytic Activity

      • N/A
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Chitin-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Other Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • N/A
    • DRAMP00984 helical wheel diagram
    • Formula

    • C127H198N42O39S7
    • Absent Amino Acids

    • DHILNTW
    • Common Amino Acids

    • G
    • Mass

    • 3679.1
    • PI

    • 8.38
    • Basic Residues

    • 4
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 3
    • Boman Index

    • -49.84
    • Hydrophobicity

    • -41.33
    • Aliphatic Index

    • 13
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 115.69
    • Polar Residues

    • 17

DRAMP00984

DRAMP00984 chydropathy plot
    • PTM

    • Contains three disulfide bonds 4-15; 9-21; 14-28.
  • Literature 1
    • Title

    • An antimicrobial peptide Ar-AMP from amaranth (Amaranthus retroflexus L.) seeds.
    • Reference

    • Phytochemistry. 2005 Oct;66(20):2426-2431.
    • Author

    • Lipkin A, Anisimova V, Nikonorova A, Babakov A, Krause E, Bienert M, Grishin E, Egorov T.