General Information

    • DRAMP ID

    • DRAMP00984

    • Peptide Name

    • Antimicrobial peptide Ar-AMP (Ar-AMP; hevin-like peptides; Plant defensin)

    • Source

    • Amaranthus retroflexus (Redroot amaranth) (Redroot pigweed)

    • Family

    • Belongs to the hevein-like family

    • Gene

    • Not found

    • Sequence

    • AGECVQGRCPSGMCCSQFGYCGRGPKYCGR

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

    • Target Organism

      • Fungi: Botrytis cinerea, Fusarium culmorum, Helminthosporium sativum and Alternaria consortiale.
      • Gram-positive bacterium: Bacillus subtilis.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00984 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00984.

Physicochemical Information

    • Formula

    • C127H198N42O39S7

    • Absent Amino Acids

    • DHILNTW

    • Common Amino Acids

    • G

    • Mass

    • 3161.65

    • PI

    • 8.68

    • Basic Residues

    • 4

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 3

    • Net Charge

    • +3

    • Boman Index

    • -49.84

    • Hydrophobicity

    • -0.413

    • Aliphatic Index

    • 13

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 115.69

    • Polar Residues

    • 17

DRAMP00984

DRAMP00984 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bonds 4-15; 9-21; 14-28.

Literature Information

  • ·Literature 1

    • Title

    • An antimicrobial peptide Ar-AMP from amaranth (Amaranthus retroflexus L.) seeds.

    • Reference

    • Phytochemistry. 2005 Oct;66(20):2426-2431.

    • Author

    • Lipkin A, Anisimova V, Nikonorova A, Babakov A, Krause E, Bienert M, Grishin E, Egorov T.