General Information

    • DRAMP ID

    • DRAMP00989

    • Peptide Name

    • Hevein (Hev b 6; Plants)

    • Source

    • Hevea brasiliensis (Para rubber tree) (Siphonia brasiliensis)

    • Family

    • Belongs to the hevein-like family

    • Gene

    • HEV1

    • Sequence

    • EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD

    • Sequence Length

    • 43

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • The first high-resolution solution-state structure of a member of the toxin-agglutinin folding motif with the WGA disulfide linkage is presented.

    • Helical Wheel Diagram

    • DRAMP00989 helical wheel diagram
  • 1HEV-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP00989.

Physicochemical Information

    • Formula

    • C188H282N60O68S8

    • Absent Amino Acids

    • FIMV

    • Common Amino Acids

    • C

    • Mass

    • 4727.15

    • PI

    • 4.83

    • Basic Residues

    • 4

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 5

    • Net Charge

    • -1

    • Boman Index

    • -104.24

    • Hydrophobicity

    • -1.019

    • Aliphatic Index

    • 20.47

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12990

    • Absorbance 280nm

    • 309.29

    • Polar Residues

    • 23

DRAMP00989

DRAMP00989 chydropathy plot

Comments Information

    • Function

    • N-acetyl-D-glucosamine / N-acetyl-D-neuraminic acid binding lectin. Can inhibit fungal growth.

    • PTM

    • Proteolytically processed to yield the two chains of the mature protein, and it Contains four disulfide bonds 3-18; 12-24; 17-31; 37-41.

    • Allergenic properties

    • Causes an allergic reaction in human.

Literature Information

  • ·Literature 1

    • Title

    • Wound-induced accumulation of mRNA containing a hevein sequence in laticifers of rubber tree (Hevea brasiliensis).

    • Reference

    • Proc Natl Acad Sci U S A. 1990 Oct;87(19):7633-7637.

    • Author

    • Broekaert I, Lee HI, Kush A, Chua NH, Raikhel N.
  • ·Literature 2

    • Title

    • Hevein: NMR assignment and assessment of solution-state folding for the agglutinin-toxin motif.

    • Reference

    • Biochemistry. 1993 Feb 16;32(6):1407-1422.

    • Author

    • Andersen NH, Cao B, Rodríguez-Romero A, Arreguin B.