• DRAMP ID

    • DRAMP00989
    • Peptide Name

    • Hevein (Hev b 6; Plants)
    • Source

    • Hevea brasiliensis (Para rubber tree) (Siphonia brasiliensis)
    • Family

    • Belongs to the hevein-like family
    • Gene

    • HEV1
    • Sequence

    • EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD
    • Sequence Length

    • 43
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Chitin-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Combine helix and strand structure
    • Structure Description

    • The first high-resolution solution-state structure of a member of the toxin-agglutinin folding motif with the WGA disulfide linkage is presented.
    • Helical Wheel Diagram

    • DRAMP00989 helical wheel diagram
    • Predicted Structure

    • There is no predicted structure for DRAMP00989.
    • Formula

    • C188H282N60O68S8
    • Absent Amino Acids

    • FIMV
    • Common Amino Acids

    • C
    • Mass

    • 4727.15
    • PI

    • 4.83
    • Basic Residues

    • 4
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 5
    • Net Charge

    • -1
    • Boman Index

    • -104.24
    • Hydrophobicity

    • -1.019
    • Aliphatic Index

    • 20.47
    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 12990
    • Absorbance 280nm

    • 309.29
    • Polar Residues

    • 23

DRAMP00989

DRAMP00989 chydropathy plot
    • Function

    • N-acetyl-D-glucosamine / N-acetyl-D-neuraminic acid binding lectin. Can inhibit fungal growth.
    • PTM

    • Proteolytically processed to yield the two chains of the mature protein, and it Contains four disulfide bonds 3-18; 12-24; 17-31; 37-41.
    • Allergenic properties

    • Causes an allergic reaction in human.
  • ·Literature 1
    • Title

    • Wound-induced accumulation of mRNA containing a hevein sequence in laticifers of rubber tree (Hevea brasiliensis).
    • Reference

    • Proc Natl Acad Sci U S A. 1990 Oct;87(19):7633-7637.
    • Author

    • Broekaert I, Lee HI, Kush A, Chua NH, Raikhel N.
  • ·Literature 2
    • Title

    • Hevein: NMR assignment and assessment of solution-state folding for the agglutinin-toxin motif.
    • Reference

    • Biochemistry. 1993 Feb 16;32(6):1407-1422.
    • Author

    • Andersen NH, Cao B, Rodríguez-Romero A, Arreguin B.