• DRAMP ID

    • DRAMP00991
    • Peptide Name

    • Pseudo-hevein (Minor hevein; hevein-like peptides; Plants)
    • Source

    • Hevea brasiliensis (Para rubber tree)
    • Family

    • N/A
    • Gene

    • N/A
    • Sequence

    • EQCGRQAGGKLCPNNLCCSQYGWCGSSDDYCSPSKNCQSNCKGGG
    • Sequence Length

    • 45
    • Evidence code

    • Protein level
    • Biological Activity

    • Antifungal, Antimicrobial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic Activity

      • N/A
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Chitin-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Other Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • N/A
    • DRAMP00991 helical wheel diagram
    • Formula

    • C185H286N60O68S8
    • Absent Amino Acids

    • FHIMTV
    • Common Amino Acids

    • CG
    • Mass

    • 5480.17
    • PI

    • 7.6
    • Basic Residues

    • 4
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 4
    • Boman Index

    • -93.48
    • Hydrophobicity

    • -88.89
    • Aliphatic Index

    • 19.56
    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8980
    • Absorbance 280nm

    • 204.09
    • Polar Residues

    • 28

DRAMP00991

DRAMP00991 chydropathy plot
    • Function

    • N-acetyl-D-glucosamine / N-acetyl-D-neuraminic acid binding lectin. Can inhibit fungal growth.
    • PTM

    • Problely Contains four disulfide bonds 3-18; 12-24; 17-31; 37-41.
  • Literature 1
    • Title

    • Demonstration by mass spectrometry that pseudo-hevein and hevein have ragged C-terminal sequences.
    • Reference

    • Biochim Biophys Acta. 1994 Nov 16;1209(1):144-148.
    • Author

    • Soedjanaatmadja UM, Hofsteenge J, Jeronimus-Stratingh CM, Bruins AP, Beintema JJ.