General Information

    • DRAMP ID

    • DRAMP00991

    • Peptide Name

    • Pseudo-hevein (Minor hevein; hevein-like peptides; Plants)

    • Source

    • Hevea brasiliensis (Para rubber tree)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • EQCGRQAGGKLCPNNLCCSQYGWCGSSDDYCSPSKNCQSNCKGGG

    • Sequence Length

    • 45

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00991 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00991.

Physicochemical Information

    • Formula

    • C185H286N60O68S8

    • Absent Amino Acids

    • FHIMTV

    • Common Amino Acids

    • CG

    • Mass

    • 4695.15

    • PI

    • 7.76

    • Basic Residues

    • 4

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 4

    • Net Charge

    • +1

    • Boman Index

    • -93.48

    • Hydrophobicity

    • -0.889

    • Aliphatic Index

    • 19.56

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 204.09

    • Polar Residues

    • 28

DRAMP00991

DRAMP00991 chydropathy plot

Comments Information

    • Function

    • N-acetyl-D-glucosamine / N-acetyl-D-neuraminic acid binding lectin. Can inhibit fungal growth.

    • PTM

    • Problely Contains four disulfide bonds 3-18; 12-24; 17-31; 37-41.

Literature Information

  • ·Literature 1

    • Title

    • Demonstration by mass spectrometry that pseudo-hevein and hevein have ragged C-terminal sequences.

    • Reference

    • Biochim Biophys Acta. 1994 Nov 16;1209(1):144-148.

    • Author

    • Soedjanaatmadja UM, Hofsteenge J, Jeronimus-Stratingh CM, Bruins AP, Beintema JJ.