General Information

    • DRAMP ID

    • DRAMP00999

    • Peptide Name

    • Plectasin (fungal defensin)

    • Source

    • Pseudoplectania nigrella (Ebony cup)

    • Family

    • Not found

    • Gene

    • DEF

    • Sequence

    • GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY

    • Sequence Length

    • 40

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

    • Target Organism

      • Gram-positive bacterium: Streptococcus pneumoniae.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid II

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00999 helical wheel diagram

    • PDB ID

    • 1ZFU resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP00999.

Physicochemical Information

    • Formula

    • C189H273N53O56S7

    • Absent Amino Acids

    • LRT

    • Common Amino Acids

    • G

    • Mass

    • 4407.99

    • PI

    • 7.77

    • Basic Residues

    • 7

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +3

    • Boman Index

    • -56.07

    • Hydrophobicity

    • -0.695

    • Aliphatic Index

    • 19.5

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 10345

    • Absorbance 280nm

    • 265.26

    • Polar Residues

    • 20

DRAMP00999

DRAMP00999 chydropathy plot

Comments Information

    • Function

    • Recombinant peptide is especially active against Streptococcus pneumoniae, including strains resistant to conventional antibiotics. Plectasin showes extremely low toxicity in mice, and cured them of experimental peritonitis and pneumonia caused by S. pneumoniae as efficaciously as vancomycin and penicillin.

Literature Information

  • ·Literature 1

    • Title

    • Plectasin is a peptide antibiotic with therapeutic potential from a saprophytic fungus.

    • Reference

    • Nature. 2005 Oct 13;437(7061):975-780.

    • Author

    • Mygind PH, Fischer RL, Schnorr KM, Hansen MT, Sönksen CP, Ludvigsen S, Ravent³s D, Buskov S, Christensen B, De Maria L, Taboureau O, Yaver D, Elvig-J¸rgensen SG, S¸rensen MV, Christensen BE, Kjaerulff S, Frimodt-Moller N, Lehrer RI, Zasloff M, Kristensen