General Information

    • DRAMP ID

    • DRAMP01007

    • Peptide Name

    • Non-specific lipid transfer peptide (LTP 1; nsLTP; Plants)

    • Source

    • Vigna radiata var. radiata (Mung bean) (Phaseolus aureus)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MTCGQVQGNLAQCIGFLQKGGVVPPSCCTGVKNILNSSRTTADRRAVCSCLKAAAGAVRGINPNNAEALPGKCGVNIPYKISTSTNCNSIN

    • Sequence Length

    • 91

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

    • Target Organism

      • Fungi: Fusarium solani, Fusarium oxysporum, Pythium aphanidermatum, Sclerotium rolfsii.
      • Gram-positive Bacterium: Staphylococcus aureus.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Alpha helix (4 helices; 46 residues)

    • Structure Description

    • The global fold of mung bean nsLTP1 is similar to those of the monocotyledonous nsLTP1 structures and consists of four alpha-helices stabilized by four disulfide bonds.

    • Helical Wheel Diagram

    • DRAMP01007 helical wheel diagram

    • PDB ID

    • 1SIY resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP01007.

Physicochemical Information

    • Formula

    • C388H652N122O124S9

    • Absent Amino Acids

    • HW

    • Common Amino Acids

    • GNA

    • Mass

    • 9298.73

    • PI

    • 9.25

    • Basic Residues

    • 9

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 28

    • Net Charge

    • +7

    • Boman Index

    • -107.22

    • Hydrophobicity

    • -0.003

    • Aliphatic Index

    • 79.34

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1990

    • Absorbance 280nm

    • 22.11

    • Polar Residues

    • 42

DRAMP01007

DRAMP01007 chydropathy plot

Comments Information

    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

    • PTM

    • Contains four disulfide bonds 3-50; 13-27; 28-73; 48-87.

Literature Information

  • ·Literature 1

    • Title

    • A non-specific lipid transfer protein with antifungal and antibacterial activities from the mung bean.

    • Reference

    • Peptides. 2004 Aug;25(8):1235-1242.

    • Author

    • Wang SY, Wu JH, Ng TB, Ye XY, Rao PF.
  • ·Literature 2

    • Title

    • Characterization and structural analyses of nonspecific lipid transfer protein 1 from mung bean.

    • Reference

    • Biochemistry. 2005 Apr 19;44(15):5703-5712.

    • Author

    • Lin KF, Liu YN, Hsu ST, Samuel D, Cheng CS, Bonvin AM, Lyu PC.