• DRAMP ID

    • DRAMP01016
    • Peptide Name

    • Antimicrobial peptide 1 (MJ-AMP1; Plant defensin)
    • Source

    • Mirabilis jalapa (Garden four-o'clock)
    • Family

    • Belongs to the AMP family
    • Gene

    • AMP1
    • Sequence

    • QCIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR
    • Sequence Length

    • 37
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial, Antifungal, Anti-Gram+, Antimicrobial
    • Target Organism

      • Fungi: Alternaria brassicola (MIC=20 µg/ml), Ascochyta pisi (MIC=200 µg/ml), Botrytis cinerea (MIC=50 µg/ml), Cercospora beticola (MIC=10 µg/ml), Colletotrichum lindemuthianum (MIC=6 µg/ml), Fusarium culmorum (MIC=30 µg/ml), Fusarium oxysporum f.sp.pisi (MIC=15 µg/ml), Fusarium oxysporum f.sp.lycopersici (MIC=200 µg/ml), Nectria haematococca (MIC=15 µg/ml), Phoma betae (MIC=25 µg/ml), Pyrenophora tritici-repentis (MIC=300 µg/ml), Pyricularia oryzae (MIC=6 µg/ml), Rhizoctonia solani (MIC=60 µg/ml), Verticillium dahliae (MIC=12 µg/ml), Venturia inequalis (MIC=12 µg/ml).
      • Gram-positive bacteria: Bacillus megaterium (MIC=6 µg/ml), Sarcina lutea (MIC=100 µg/ml).
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Bridge
    • Structure Description

    • Unknown
    • DRAMP01016 helical wheel diagram
    • Formula

    • C165H252N54O51S6
    • Absent Amino Acids

    • ADHMTW
    • Common Amino Acids

    • G
    • Mass

    • 4642.82
    • PI

    • 8.37
    • Basic Residues

    • 4
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 4
    • Boman Index

    • -72.06
    • Hydrophobicity

    • -75.14
    • Aliphatic Index

    • 28.92
    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 4845
    • Absorbance 280nm

    • 134.58
    • Polar Residues

    • 22

DRAMP01016

DRAMP01016 chydropathy plot
    • Function

    • Possesses antifungal activity and is also active on two tested Gram-positive bacteria
    • Tissue specificity

    • Found only in seeds.
    • PTM

    • Contains three disulfide bonds 2-19; 9-23;
  • Literature 1
    • Reference

    • J. Biol. Chem. 1992;267:2228-2233.
    • Author

    • Cammue B.P.A, de Bolle M.F.C, Terras F.R.G, Proost P, van Damme J, Rees S.B, Vanderleyden J, Broekaert W.F.
    • Title

    • Isolation and characterization of a novel class of plant antimicrobial peptides from Mirabilis jalapa L. seeds.
  • Literature 2
    • Reference

    • Plant Mol. Biol. 1995;28:713-721.
    • Author

    • de Bolle M.F, Eggermont K, Duncan R.E, Osborn R.W, Terras F.R.G, Broekaert W.F.
    • Title

    • Cloning and characterization of two cDNA clones encoding seed-specific antimicrobial peptides from Mirabilis jalapa L.