General Information

    • DRAMP ID

    • DRAMP01016

    • Peptide Name

    • Antimicrobial peptide 1 (MJ-AMP1; Plant defensin)

    • Source

    • Mirabilis jalapa (Garden four-o'clock)

    • Family

    • Belongs to the AMP family

    • Gene

    • AMP1

    • Sequence

    • QCIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR

    • Sequence Length

    • 37

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

    • Target Organism

      • Fungi: Alternaria brassicola (MIC=20 µg/ml), Ascochyta pisi (MIC=200 µg/ml), Botrytis cinerea (MIC=50 µg/ml), Cercospora beticola (MIC=10 µg/ml), Colletotrichum lindemuthianum (MIC=6 µg/ml), Fusarium culmorum (MIC=30 µg/ml), Fusarium oxysporum f.sp.pisi (MIC=15 µg/ml), Fusarium oxysporum f.sp.lycopersici (MIC=200 µg/ml), Nectria haematococca (MIC=15 µg/ml), Phoma betae (MIC=25 µg/ml), Pyrenophora tritici-repentis (MIC=300 µg/ml), Pyricularia oryzae (MIC=6 µg/ml), Rhizoctonia solani (MIC=60 µg/ml), Verticillium dahliae (MIC=12 µg/ml), Venturia inequalis (MIC=12 µg/ml).
      • Gram-positive bacteria: Bacillus megaterium (MIC=6 µg/ml), Sarcina lutea (MIC=100 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Pyroglutamyl modification (Cyclization of a N-terminal glutamine)

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • There are three disulfide bonds between Cys2 and Cys19, Cys9 and Cys23, Cys18 and Cys34.

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01016 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01016.

Physicochemical Information

    • Formula

    • C165H252N54O51S6

    • Absent Amino Acids

    • ADHMTW

    • Common Amino Acids

    • G

    • Mass

    • 4000.51

    • PI

    • 8.66

    • Basic Residues

    • 4

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 4

    • Net Charge

    • +3

    • Boman Index

    • -72.06

    • Hydrophobicity

    • -0.751

    • Aliphatic Index

    • 28.92

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 134.58

    • Polar Residues

    • 22

DRAMP01016

DRAMP01016 chydropathy plot

Comments Information

    • Function

    • Possesses antifungal activity and is also active on two tested Gram-positive bacteria

    • Tissue specificity

    • Found only in seeds.

    • PTM

    • Contains three disulfide bonds 2-19; 9-23;

Literature Information

  • ·Literature 1

    • Title

    • Isolation and characterization of a novel class of plant antimicrobial peptides from Mirabilis jalapa L. seeds.

    • Reference

    • J. Biol. Chem. 1992;267:2228-2233.

    • Author

    • Cammue B.P.A, de Bolle M.F.C, Terras F.R.G, Proost P, van Damme J, Rees S.B, Vanderleyden J, Broekaert W.F.
  • ·Literature 2

    • Title

    • Cloning and characterization of two cDNA clones encoding seed-specific antimicrobial peptides from Mirabilis jalapa L.

    • Reference

    • Plant Mol. Biol. 1995;28:713-721.

    • Author

    • de Bolle M.F, Eggermont K, Duncan R.E, Osborn R.W, Terras F.R.G, Broekaert W.F.