General Information

    • DRAMP ID

    • DRAMP01019

    • Peptide Name

    • VrD2 (Vigna radiata defensin 2; plant defensin)

    • Source

    • Vigna radiata

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • KTCENLANTYRGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTRNC

    • Sequence Length

    • 47

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01019 helical wheel diagram

    • PDB ID

    • 2GL1 resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP01019.

Physicochemical Information

    • Formula

    • C222H347N77O72S8

    • Absent Amino Acids

    • IMQV

    • Common Amino Acids

    • C

    • Mass

    • 5503.15

    • PI

    • 8.51

    • Basic Residues

    • 11

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +5

    • Boman Index

    • -177.34

    • Hydrophobicity

    • -1.175

    • Aliphatic Index

    • 18.72

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 7490

    • Absorbance 280nm

    • 162.83

    • Polar Residues

    • 23

DRAMP01019

DRAMP01019 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • NMR solution structure of Vigna radiata Defensin 2 (VrD2).

    • Reference

    • Proteins 2007; 68: 530-540.

    • Author

    • Lin KF, Lee TR, Tsai PH, Hsu MP, Chen CS, Lyu PC.