General Information

    • DRAMP ID

    • DRAMP01020

    • Peptide Name

    • SIalpha1 (Plant defensin)

    • Source

    • Sorghum bicolor

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • RVCMKGSQHHSFPCISDRLCSNECVKEEGGWTAGYCHLRYCRCQKAC

    • Sequence Length

    • 47

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01020 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01020.

Physicochemical Information

    • Formula

    • C223H348N72O66S9

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • C

    • Mass

    • 5382.2

    • PI

    • 8.51

    • Basic Residues

    • 10

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +6

    • Boman Index

    • -105.51

    • Hydrophobicity

    • -0.545

    • Aliphatic Index

    • 41.49

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 195.22

    • Polar Residues

    • 20

DRAMP01020

DRAMP01020 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • 1H NMR structure of an antifungal gamma-thionin protein SIalpha1: similarity to scorpion toxins.

    • Reference

    • Proteins. 1998 Aug 15;32(3):334-349.

    • Author

    • Bloch C Jr, Patel SU, Baud F, Zvelebil MJ, Carr MD, Sadler PJ, Thornton JM.