General Information

    • DRAMP ID

    • DRAMP01025

    • Peptide Name

    • Vicilin-like Antimicrobial peptide 2a (MiAMP2a; Plant defensin)

    • Source

    • Macadamia integrifolia (Macadamia nut)

    • Family

    • Belongs to the vicilin-like family

    • Gene

    • AMP2-2

    • Sequence

    • ESEFDRQEYEECKRQCMQLETSGQMRRCVSQCDKRFEEDIDWSKYDNQD

    • Sequence Length

    • 49

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

    • Target Organism

      • Gram-positive bacteria: (- Ca2+, + Ca2+): Clavibacter michiganensis (IC50=50, >50 µg/ml).
      • Fungi (- Ca2+, + Ca2+): Alternaria helianthi (IC50=5-10, ND µg/ml), Ceratocystis paradoxa (IC50=20-50, >50 µg/ml), Cercospora nicotianae (IC50=5-10, 5-10 µg/ml), Chalara elegans (IC50=2-5, 10-20 µg/ml), Fusarium oxysporum (IC50=10, 20-50 µg/ml), Leptosphaeria maculans (IC50=25, >50 µg/ml), Sclerotinia sclerotiorum (IC50=20-50, >50 µg/ml), Verticillium dahliae (IC50=5-10, >50 µg/ml), Saccharomyces cerevisiae (IC50=20-50, >50 µg/ml), Phytophthora cryptogea (IC50=5-10, 10-25 µg/ml), Phytophthora parasitica nicotianae (IC50=10-20, >50 µg/ml).
      • [NOTE:, Ca2+ = Medium with low content of CaCl2 (50 µM); + Ca2+ = Medium supplemented with high concentration of CaCl2 (1 mM)]

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01025 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01025.

Physicochemical Information

    • Formula

    • C250H383N75O92S6

    • Absent Amino Acids

    • AHP

    • Common Amino Acids

    • E

    • Mass

    • 6103.6

    • PI

    • 4.43

    • Basic Residues

    • 8

    • Acidic Residues

    • 14

    • Hydrophobic Residues

    • 6

    • Net Charge

    • -6

    • Boman Index

    • -221.45

    • Hydrophobicity

    • -1.706

    • Aliphatic Index

    • 21.84

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8730

    • Absorbance 280nm

    • 181.88

    • Polar Residues

    • 13

DRAMP01025

DRAMP01025 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • A family of antimicrobial peptides is produced by processing of a 7S globulin protein in Macadamia integrifolia kernels.

    • Reference

    • Plant J. 1999 Sep;19(6):699-710.

    • Author

    • Marcus JP, Green JL, Goulter KC, Manners JM.