• DRAMP ID

    • DRAMP01039
    • Peptide Name

    • Vicilin-like Antimicrobial peptide 2c-2 (MiAMP2c-2; Plant defensin)
    • Source

    • Macadamia integrifolia (Macadamia nut)
    • Family

    • Belongs to the vicilin-like family
    • Gene

    • AMP2-1
    • Sequence

    • RQRDPQQQYEQCQKHCQRRETEPRHMQTCQQRCERRYEKEKRKQQKR
    • Sequence Length

    • 47
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal
    • Target Organism

      • Gram-positive bacteria: (- Ca2+, + Ca2+): Clavibacter michiganensis (IC50=50, >50 µg/ml);
      • Fungi (- Ca2+, + Ca2+): Alternaria helianthi (IC50=5-10, ND µg/ml), Ceratocystis paradoxa (IC50=20-50, >50 µg/ml), Cercospora nicotianae (IC50=5-10, 5-10 µg/ml), Chalara elegans (IC50=2-5, 10-20 µg/ml), Fusarium oxysporum (IC50=10, 20-50 µg/ml), Leptosphaeria maculans (IC50=25, >50 µg/ml), Sclerotinia sclerotiorum (IC50=20-50, >50 µg/ml), Verticillium dahliae (IC50=5-10, >50 µg/ml), Saccharomyces cerevisiae (IC50=20-50, >50 µg/ml), Phytophthora cryptogea (IC50=5-10, 10-25 µg/ml), Phytophthora parasitica nicotianae (IC50=10-20, >50 µg/ml).
      • [NOTE:, Ca2+ = Medium with low content of CaCl2 (50 µM); + Ca2+ = Medium supplemented with high concentration of CaCl2 (1 mM)]
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01039 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01039.
    • Formula

    • C249H414N98O78S5
    • Absent Amino Acids

    • AFGILNSVW
    • Common Amino Acids

    • Q
    • Mass

    • 6188.94
    • PI

    • 9.95
    • Basic Residues

    • 17
    • Acidic Residues

    • 7
    • Hydrophobic Residues

    • 0
    • Net Charge

    • +10
    • Boman Index

    • -300.28
    • Hydrophobicity

    • -2.823
    • Aliphatic Index

    • 0
    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 3230
    • Absorbance 280nm

    • 70.22
    • Polar Residues

    • 8

DRAMP01039

DRAMP01039 chydropathy plot
    • Function

    • Antimicrobial peptides 2c has antibacterial and antifungal activity against a range of species (By similarity).
  • ·Literature 1
    • Title

    • A family of antimicrobial peptides is produced by processing of a 7S globulin protein in Macadamia integrifolia kernels.
    • Reference

    • Plant J. 1999 Sep;19(6):699-710.
    • Author

    • Marcus JP, Green JL, Goulter KC, Manners JM.