General Information

    • DRAMP ID

    • DRAMP01043

    • Peptide Name

    • TPP3 (Plant defensin)

    • Source

    • Lycopersicon esculentum

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • QICKAPSQTFPGLCFMDSSCRKYCIKEKFTGGHCSKLQRKCLCTKPC

    • Sequence Length

    • 47

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01043 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP01043.

Physicochemical Information

    • Formula

    • C227H369N65O63S9

    • Absent Amino Acids

    • NVW

    • Common Amino Acids

    • C

    • Mass

    • 5305.36

    • PI

    • 9.2

    • Basic Residues

    • 10

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +8

    • Boman Index

    • -76.19

    • Hydrophobicity

    • -0.364

    • Aliphatic Index

    • 43.62

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1990

    • Absorbance 280nm

    • 43.26

    • Polar Residues

    • 19

DRAMP01043

DRAMP01043 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Nature and regulation of pistil-expressed genes in tomato.

    • Reference

    • Plant Mol Biol 1995; 28:691-711.

    • Author

    • Milligan SB, Gasser CS.