General Information

    • DRAMP ID

    • DRAMP01044

    • Peptide Name

    • Defensin-like protein (Clone PSAS10; Plant defensin)

    • Source

    • Vigna unguiculata (cowpea seeds)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • KTCENLVDTYRGPCFTTGSCDDHCKNKEHLLSGRCRDDVRCWCTRNC

    • Sequence Length

    • 47

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01044 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01044.

Physicochemical Information

    • Formula

    • C220H349N73O73S8

    • Absent Amino Acids

    • AIMQ

    • Common Amino Acids

    • C

    • Mass

    • 5441.12

    • PI

    • 7.72

    • Basic Residues

    • 10

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +3

    • Boman Index

    • -156.29

    • Hydrophobicity

    • -0.917

    • Aliphatic Index

    • 37.23

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 7490

    • Absorbance 280nm

    • 162.83

    • Polar Residues

    • 22

DRAMP01044

DRAMP01044 chydropathy plot

Comments Information

    • This protein is required for germination.

Literature Information

  • ·Literature 1

    • Title

    • Stored mRNA in cotyledons of Vigna unguiculata seeds: nucleotide sequence of cloned cDNA for a stored mRNA and induction of its synthesis by precocious germination.

    • Reference

    • Plant Mol Biol. 1990 Jul;15(1):59-64.

    • Author

    • Ishibashi N, Yamauchi D, Minamikawa T.