General Information

    • DRAMP ID

    • DRAMP01048

    • Peptide Name

    • Sd5 (sugarcane defensin 5; Plant defensin)

    • Source

    • Saccharum officinarum (Sugarcane)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • HTPTPTPICKSRSHEYKGRCIQDMDCNAACVKESESYTGGFCNGRPPFKQCFCTKPCKRERAAATLRWPGL

    • Sequence Length

    • 71

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Neurospora crassa and Fusarium solani (IC50=10-15 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Based on circular dichroism (CD) and nuclear magnetic resonance (NMR) spectroscopy showed that the structures of these Sds were compatible with alpha/beta proteins, a feature expected for plant defensins.

    • Helical Wheel Diagram

    • DRAMP01048 helical wheel diagram

    • PDB ID

    • 2KSK resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP01048.

Physicochemical Information

    • Formula

    • C340H534N104O100S9

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • CP

    • Mass

    • 7967.16

    • PI

    • 9.05

    • Basic Residues

    • 14

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +8

    • Boman Index

    • -169.15

    • Hydrophobicity

    • -0.786

    • Aliphatic Index

    • 33.1

    • Half Life

      • Mammalian:3.5 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 128.29

    • Polar Residues

    • 27

DRAMP01048

DRAMP01048 chydropathy plot

Comments Information

    • Function

    • Sd5 is active against fungi, but not against bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Evolutionary relationship between defensins in the Poaceae family strengthened by the characterization of new sugarcane defensins.

    • Reference

    • Plant Mol Biol. 2008 Nov;68(4-5):321-335.

    • Author

    • De-Paula VS, Razzera G, Medeiros L, Miyamoto CA, Almeida MS, Kurtenbach E, Almeida FC, Valente AP.