General Information

    • DRAMP ID

    • DRAMP01049

    • Peptide Name

    • Sd3 (sugarcane defensin 3; Plant defensin)

    • Source

    • Saccharum officinarum (Sugarcane)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • RHRHCFSQSHKFVGACLRESNCENVCKTEGFPSGECKWHGIVSKCHCKRIC

    • Sequence Length

    • 51

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Neurospora crassa and Aspergillus niger (IC50=1-3.5 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Based on circular dichroism (CD) and nuclear magnetic resonance (NMR) spectroscopy showed that the structures of these Sds were compatible with alpha/beta proteins, a feature expected for plant defensins.

    • Helical Wheel Diagram

    • DRAMP01049 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01049.

Physicochemical Information

    • Formula

    • C247H386N82O69S8

    • Absent Amino Acids

    • DMY

    • Common Amino Acids

    • C

    • Mass

    • 5864.77

    • PI

    • 8.92

    • Basic Residues

    • 14

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +10

    • Boman Index

    • -122.4

    • Hydrophobicity

    • -0.612

    • Aliphatic Index

    • 41.96

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6000

    • Absorbance 280nm

    • 120

    • Polar Residues

    • 20

DRAMP01049

DRAMP01049 chydropathy plot

Comments Information

    • Function

    • Sd3 is active against fungi, but not against bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Evolutionary relationship between defensins in the Poaceae family strengthened by the characterization of new sugarcane defensins.

    • Reference

    • Plant Mol Biol. 2008 Nov;68(4-5):321-335.

    • Author

    • De-Paula VS, Razzera G, Medeiros L, Miyamoto CA, Almeida MS, Kurtenbach E, Almeida FC, Valente AP.