General Information

    • DRAMP ID

    • DRAMP01050

    • Peptide Name

    • Sd1 (sugarcane defensin 1; Plant defensin)

    • Source

    • Saccharum officinarum (Sugarcane)

    • Family

    • Not found

    • Gene

    • PDEF

    • Sequence

    • RYCLSQSHRFKGLCMSSSNCANVCQTENFPGGECKADGATRKCFCKKIC

    • Sequence Length

    • 49

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Neurospora crassa, Aspergillus niger, Fusarium solani (IC50=1-2 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Based on circular dichroism (CD) and nuclear magnetic resonance (NMR) spectroscopy showed that the structures of these Sds were compatible with alpha/beta proteins, a feature expected for plant defensins.

    • Helical Wheel Diagram

    • DRAMP01050 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01050.

Physicochemical Information

    • Formula

    • C223H358N70O69S9

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • C

    • Mass

    • 5412.26

    • PI

    • 8.91

    • Basic Residues

    • 9

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +6

    • Boman Index

    • -103.27

    • Hydrophobicity

    • -0.451

    • Aliphatic Index

    • 35.92

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 1990

    • Absorbance 280nm

    • 41.46

    • Polar Residues

    • 23

DRAMP01050

DRAMP01050 chydropathy plot

Comments Information

    • Function

    • Sd1 is active against fungi, but not against bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Evolutionary relationship between defensins in the Poaceae family strengthened by the characterization of new sugarcane defensins.

    • Reference

    • Plant Mol Biol. 2008 Nov;68(4-5):321-335.

    • Author

    • De-Paula VS, Razzera G, Medeiros L, Miyamoto CA, Almeida MS, Kurtenbach E, Almeida FC, Valente AP.
  • ·Literature 2

    • Title

    • Novel plant-defensin from sugarcane (Saccharum officinarum).

    • Reference

    • Submitted (FEB-2008) to the EMBL/GenBank/DDBJ databases.

    • Author

    • Padovan L, Segat L, Tossi A, Crovella S.