General Information

    • DRAMP ID

    • DRAMP01055

    • Peptide Name

    • P. americana AMP (Pa-AMP-1; PAFP-S; Cys-rich; Plant defensin)

    • Source

    • Phytolacca americana (American pokeweed) (Phytolacca decandra)

    • Family

    • Belongs to the AMP family

    • Gene

    • Not found

    • Sequence

    • AGCIKNGGRCNASAGPPYCCSSYCFQIAGQSYGVCKNR

    • Sequence Length

    • 38

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

    • Target Organism

      • Gram-positive bacteria: Bacillus megaterium (IC50=8 µg/ml), Staphyanococcus sp. (IC50=11 µg/ml).
      • Fungi: Alternaria panax, Fusarium sp., Rhizoctonia solani.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Beta strand (3 strands; 13 residues)

    • Structure Description

    • The global fold involves a cystine-knotted three-stranded antiparallel beta-sheet (residues 8-10, 23-27, 32-36), a flexible loop (residues 14-19), and four beta-reverse turns (residues 4-8, 11-14, 19-22, 28-32). This structure features all the characteristics of the knottin fold. It is the first structural model of an antifungal peptide that adopts a knottin-type structure.

    • Helical Wheel Diagram

    • DRAMP01055 helical wheel diagram

    • PDB ID

    • 1DKC resolved by NMR.
  • 1DKC-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP01055.

Physicochemical Information

    • Formula

    • C163H253N51O51S6

    • Absent Amino Acids

    • DEHLMTW

    • Common Amino Acids

    • CG

    • Mass

    • 3935.47

    • PI

    • 8.9

    • Basic Residues

    • 4

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +4

    • Boman Index

    • -48.54

    • Hydrophobicity

    • -0.232

    • Aliphatic Index

    • 38.68

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 130.95

    • Polar Residues

    • 22

DRAMP01055

DRAMP01055 chydropathy plot

Comments Information

    • Function

    • Possesses antifungal activity.

    • Tissue specificity

    • Seed specific.

    • Domain

    • The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.

    • PTM

    • Contains three disulfide bonds

Literature Information

  • ·Literature 1

    • Title

    • Purification, characterization, and molecular cloning of the gene of a seed-specific antimicrobial protein from pokeweed.

    • Reference

    • Plant Physiol. 2000 Apr;122(4):1015-1024.

    • Author

    • Liu Y, Luo J, Xu C, Ren F, Peng C, Wu G, Zhao J.
  • ·Literature 2

    • Title

    • Solution structure of PAFP-S: a new knottin-type antifungal peptide from the seeds of Phytolacca americana.

    • Reference

    • Biochemistry. 2001 Sep 18;40(37):10973-10978.

    • Author

    • Gao GH, Liu W, Dai JX, Wang JF, Hu Z, Zhang Y, Wang DC.