• DRAMP ID

    • DRAMP01068
    • Peptide Name

    • Non-specific lipid-transfer protein (Plant defensin)
    • Source

    • Hordeum vulgare (Barley)
    • Family

    • Belongs to the plant LTP family
    • Gene

    • ltp1
    • Sequence

    • LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRIY
    • Sequence Length

    • 91
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Lipid-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01068 helical wheel diagram
    • Predicted Structure

    • There is no predicted structure for DRAMP01068.
    • Formula

    • C404H656N126O133S9
    • Absent Amino Acids

    • FW
    • Common Amino Acids

    • NG
    • Mass

    • 9694.96
    • PI

    • 8.19
    • Basic Residues

    • 10
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 22
    • Net Charge

    • +4
    • Boman Index

    • -159.47
    • Hydrophobicity

    • -0.385
    • Aliphatic Index

    • 74.95
    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 4970
    • Absorbance 280nm

    • 55.22
    • Polar Residues

    • 41

DRAMP01068

DRAMP01068 chydropathy plot
    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).
  • ·Literature 1
    • Title

    • Behaviour of foam components in gushing beer.
    • Reference

    • Submitted (OCT-2007) to the EMBL/GenBank/DDBJ databases
    • Author

    • Niessen L.