General Information

    • DRAMP ID

    • DRAMP01069

    • Peptide Name

    • Putative plant defensin SPI1B (Plants)

    • Source

    • Picea abies (Norway spruce) (Picea excelsa)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MADKGVGSRLSALFLLVLLVISIGMMQLEPAEGRTCKTPSGKFKGVCASRNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPCP

    • Sequence Length

    • 83

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01069 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01069.

Physicochemical Information

    • Formula

    • C381H622N110O112S11

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • CGSKL

    • Mass

    • 8888.46

    • PI

    • 9.04

    • Basic Residues

    • 12

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 24

    • Net Charge

    • +7

    • Boman Index

    • -99.45

    • Hydrophobicity

    • -0.016

    • Aliphatic Index

    • 69.28

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1990

    • Absorbance 280nm

    • 24.27

    • Polar Residues

    • 32

DRAMP01069

DRAMP01069 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • The putative gymnosperm plant defensin (SPI1) accumulates after seed germination and a related SPI1B cDNA is found in needles.

    • Reference

    • Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases

    • Author

    • Fossdal CG.