• DRAMP ID

    • DRAMP01069
    • Peptide Name

    • Putative plant defensin SPI1B (Plants)
    • Source

    • Picea abies (Norway spruce) (Picea excelsa)
    • Family

    • N/A
    • Gene

    • N/A
    • Sequence

    • MADKGVGSRLSALFLLVLLVISIGMMQLEPAEGRTCKTPSGKFKGVCASRNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPCP
    • Sequence Length

    • 83
    • Evidence code

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic Activity

      • N/A
    • Cytotoxicity

    • Binding Target

    • N/A
    • Linear/Cyclic/Branched

    • N-terminal modification

    • C-terminal modification

    • Other modifications

    • Stereochemistry

    • Structure

    • N/A
    • Structure Description

    • N/A
    • DRAMP01069 helical wheel diagram
    • Formula

    • C381H622N110O112S11
    • Absent Amino Acids

    • W
    • Common Amino Acids

    • CGSKL
    • Mass

    • 10000
    • PI

    • 8.79
    • Basic Residues

    • 12
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 24
    • Boman Index

    • -99.45
    • Hydrophobicity

    • -1.57
    • Aliphatic Index

    • 69.28
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1990
    • Absorbance 280nm

    • 24.27
    • Polar Residues

    • 32

DRAMP01069

DRAMP01069 chydropathy plot
    • No comments found on DRAMP database

  • Literature 1
    • Reference

    • Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases
    • Author

    • Fossdal CG.
    • Title

    • The putative gymnosperm plant defensin (SPI1) accumulates after seed germination and a related SPI1B cDNA is found in needles.