• DRAMP ID

    • DRAMP01075
    • Peptide Name

    • Non-specific lipid-transfer protein (Plants)
    • Source

    • Triticum aestivum (Wheat)
    • Family

    • Belongs to the plant LTP family
    • Gene

    • LTP
    • Sequence

    • AISCGQVSSALSPCISYARGSGSSPPAACCSGVRSLAGAARSTADKQAACKCIKSAAGGLNAGKAAGIPSKCGVSIPYAISSSVDCSKIR
    • Sequence Length

    • 90
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Lipid-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01075 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01075.
    • Formula

    • C358H605N111O119S8
    • Absent Amino Acids

    • EFHMW
    • Common Amino Acids

    • SA
    • Mass

    • 8624.89
    • PI

    • 9.35
    • Basic Residues

    • 10
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 31
    • Net Charge

    • +8
    • Boman Index

    • -76.42
    • Hydrophobicity

    • 0.241
    • Aliphatic Index

    • 75.11
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3480
    • Absorbance 280nm

    • 39.1
    • Polar Residues

    • 40

DRAMP01075

DRAMP01075 chydropathy plot
    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).
  • ·Literature 1
    • Title

    • Characterization and antifungal properties of wheat nonspecific lipid transfer proteins.
    • Reference

    • Mol Plant Microbe Interact. 2008 Mar;21(3):346-360.
    • Author

    • Sun JY, Gaudet DA, Lu ZX, Frick M, Puchalski B, Laroche A.