• DRAMP ID

    • DRAMP01080
    • Peptide Name

    • Non-specific lipid-transfer protein (Plants)
    • Source

    • Fragaria ananassa (Strawberry)
    • Family

    • Belongs to the plant LTP family
    • Gene

    • LTP6
    • Sequence

    • AITCGQVTHNVAPCFNYVKSGGAVPAACCKGVSNLNSMAKTTADRQQTCNCLKSAAGSIKGLNANLAAGLPGKCGVNVPYKISTSTNCNNVK
    • Sequence Length

    • 92
    • Evidence code

    • Homology
    • Biological Activity

    • Antimicrobial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic Activity

      • N/A
    • Cytotoxicity

    • Binding Target

    • Lipid-binding
    • Linear/Cyclic/Branched

    • N-terminal modification

    • C-terminal modification

    • Other modifications

    • Stereochemistry

    • Structure

    • N/A
    • Structure Description

    • N/A
    • DRAMP01080 helical wheel diagram
    • Formula

    • C390H647N119O125S9
    • Absent Amino Acids

    • EW
    • Common Amino Acids

    • AN
    • Mass

    • 10000
    • PI

    • 9.23
    • Basic Residues

    • 10
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 29
    • Boman Index

    • -87
    • Hydrophobicity

    • -2.28
    • Aliphatic Index

    • 72.17
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3480
    • Absorbance 280nm

    • 38.24
    • Polar Residues

    • 44

DRAMP01080

DRAMP01080 chydropathy plot
    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).
  • Literature 1
    • Reference

    • Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases
    • Author

    • Zuidmeer L, Salentijn EMJ.
    • Title

    • Cross-reactivity of a recombinant non-specific lipid transfer protein from strawberry.