General Information

    • DRAMP ID

    • DRAMP01080

    • Peptide Name

    • Non-specific lipid-transfer protein (Plants)

    • Source

    • Fragaria ananassa (Strawberry)

    • Family

    • Belongs to the plant LTP family

    • Gene

    • LTP6

    • Sequence

    • AITCGQVTHNVAPCFNYVKSGGAVPAACCKGVSNLNSMAKTTADRQQTCNCLKSAAGSIKGLNANLAAGLPGKCGVNVPYKISTSTNCNNVK

    • Sequence Length

    • 92

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01080 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01080.

Physicochemical Information

    • Formula

    • C390H647N119O125S9

    • Absent Amino Acids

    • EW

    • Common Amino Acids

    • AN

    • Mass

    • 9291.69

    • PI

    • 9.3

    • Basic Residues

    • 10

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 29

    • Net Charge

    • +9

    • Boman Index

    • -87

    • Hydrophobicity

    • -0.023

    • Aliphatic Index

    • 72.17

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3480

    • Absorbance 280nm

    • 38.24

    • Polar Residues

    • 44

DRAMP01080

DRAMP01080 chydropathy plot

Comments Information

    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Cross-reactivity of a recombinant non-specific lipid transfer protein from strawberry.

    • Reference

    • Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases

    • Author

    • Zuidmeer L, Salentijn EMJ.