General Information

    • DRAMP ID

    • DRAMP01160

    • Peptide Name

    • Uperin-6.2 (toads, amphibians, animals)

    • Source

    • Uperoleia inundata (Floodplain toadlet)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GLAGAISSVLDKLKQSQLIKNYAKKLGYPR

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Unknown

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01160 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01160.

Physicochemical Information

    • Formula

    • C148H251N41O41

    • Absent Amino Acids

    • CEFHMTW

    • Common Amino Acids

    • KL

    • Mass

    • 3260.87

    • PI

    • 10.12

    • Basic Residues

    • 6

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +5

    • Boman Index

    • -32.86

    • Hydrophobicity

    • -0.273

    • Aliphatic Index

    • 110.67

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 2980

    • Absorbance 280nm

    • 102.76

    • Polar Residues

    • 9

DRAMP01160

DRAMP01160 chydropathy plot

Comments Information

    • Function

    • Amphibian defense peptide.

    • Tissue specificity

    • Expressed by the skin dorsal glands.

Literature Information

  • ·Literature 1

    • Title

    • Novel uperin peptides from the dorsal glands of the australian floodplain toadlet Uperoleia inundata.

    • Reference

    • Aust. J. Chem. 1996; 49:475-484.

    • Author

    • Bradford AM, Raftery MJ, Bowie JH, Tyler MJ, Wallace JC, Adams GW, Severini C.