General Information

    • DRAMP ID

    • DRAMP01162

    • Peptide Name

    • Buforin-1 (Buforin I; Fragment of Histone H2A; toads, amphibians, animals)

    • Source

    • Bufo gargarizans (Asian toad) (Bufo bufo gargarizans)

    • Family

    • Belongs to the histone H2A family

    • Gene

    • N/A

    • Sequence

    • AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY

    • Sequence Length

    • 39

    • Evidence code

    • Protein level

Activity Information

    • Biological Activity

    • Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-, Antimicrobial

    • Target Organism

      • Gram-positive bacteria: Bacillus subtilis (MIC=4 µg/ml), Staphylococcus aureus (MIC=4 µg/ml), Streptococcus mutans (MIC=8 µg/ml), Streptococcus pneumoniae (MIC=4 µg/ml), Pseudomonas putida (MIC=4 µg/ml);
      • Gram-negative bacteria: Escherichia coli (MIC=8 µg/ml), Salmonella typhimurium (MIC=4 µg/ml), Serratia sp. (MIC=8 µg/ml).
      • Fungi: Candida albicans (MIC=4 µg/ml), Cryptococcus neoformans (MIC=4 µg/ml), Saccharomyces cerevisiae (MIC=4 µg/ml).

    • Hemolytic Activity

      • N/A

    • Cytotoxicity

    • Binding Target

    • DNA

Structure Information

    • Linear/Cyclic/Branched

    • N-terminal modification

    • C-terminal modification

    • Other modifications

    • Stereochemistry

    • Structure

    • N/A

    • Structure Description

    • N/A
    • DRAMP01162 helical wheel diagram

Physical Information

    • Formula

    • C184H318N70O47

    • Absent Amino Acids

    • CDEIMW

    • Common Amino Acids

    • GR

    • Mass

    • 4940.96

    • PI

    • 12.91

    • Basic Residues

    • 13

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 11

    • Boman Index

    • -120.4

    • Hydrophobicity

    • -99.23

    • Aliphatic Index

    • 62.56

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1490

    • Absorbance 280nm

    • 39.21

    • Polar Residues

    • 12

DRAMP01162

DRAMP01162 chydropathy plot

Comments Information

    • Function

    • Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

    • PTM

    • Monoubiquitination of C-terminus gives a specific tag for epigenetic transcriptional repression. Following DNA double-strand breaks (DSBs), it is ubiquitinated through 'Lys-63' linkage of ubiquitin moieties.

Literature Information

  • Literature 1

    • Reference

    • Biochem Biophys Res Commun. 1996 Jan 5;218(1):408-413.

    • Author

    • Park C.B, Kim M.S, Kim S.C.

    • Title

    • A novel antimicrobial peptide from Bufo bufo gargarizans.
  • Literature 2

    • Reference

    • FEBS Lett. 1996 Nov 25;398(1):87-90.

    • Author

    • Yi G.-S, Park C.B, Kim S.C, Cheong C.

    • Title

    • Solution structure of an antimicrobial peptide buforin II.