• DRAMP ID

    • DRAMP01162
    • Peptide Name

    • Buforin-1 (Buforin I; Fragment of Histone H2A; toads, amphibians, animals)
    • Source

    • Bufo gargarizans (Asian toad) (Bufo bufo gargarizans)
    • Family

    • Belongs to the histone H2A family
    • Gene

    • Unknown
    • Sequence

    • AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY
    • Sequence Length

    • 39
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-, Antimicrobial
    • Target Organism

      • Gram-positive bacteria: Bacillus subtilis (MIC=4 µg/ml), Staphylococcus aureus (MIC=4 µg/ml), Streptococcus mutans (MIC=8 µg/ml), Streptococcus pneumoniae (MIC=4 µg/ml), Pseudomonas putida (MIC=4 µg/ml);
      • Gram-negative bacteria: Escherichia coli (MIC=8 µg/ml), Salmonella typhimurium (MIC=4 µg/ml), Serratia sp. (MIC=8 µg/ml).
      • Fungi: Candida albicans (MIC=4 µg/ml), Cryptococcus neoformans (MIC=4 µg/ml), Saccharomyces cerevisiae (MIC=4 µg/ml).
    • Hemolytic activity

    • Unknown
    • Binding Target

    • DNA
    • Structure

    • Unknown
    • Structure Description

    • Unknown
    • DRAMP01162 helical wheel diagram
    • Formula

    • C184H318N70O47
    • Absent Amino Acids

    • CDEIMW
    • Common Amino Acids

    • GR
    • Mass

    • 4940.96
    • PI

    • 12.91
    • Basic Residues

    • 13
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 11
    • Boman Index

    • -120.4
    • Hydrophobicity

    • -99.23
    • Aliphatic Index

    • 62.56
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1490
    • Absorbance 280nm

    • 39.21
    • Polar Residues

    • 12

DRAMP01162

DRAMP01162 chydropathy plot
    • Function

    • Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
    • PTM

    • Monoubiquitination of C-terminus gives a specific tag for epigenetic transcriptional repression. Following DNA double-strand breaks (DSBs), it is ubiquitinated through 'Lys-63' linkage of ubiquitin moieties.
  • Literature 1
    • Reference

    • Biochem Biophys Res Commun. 1996 Jan 5;218(1):408-413.
    • Author

    • Park C.B, Kim M.S, Kim S.C.
    • Title

    • A novel antimicrobial peptide from Bufo bufo gargarizans.
  • Literature 2
    • Reference

    • FEBS Lett. 1996 Nov 25;398(1):87-90.
    • Author

    • Yi G.-S, Park C.B, Kim S.C, Cheong C.
    • Title

    • Solution structure of an antimicrobial peptide buforin II.