General Information

    • DRAMP ID

    • DRAMP01187

    • Peptide Name

    • Chensinin-3CE (Frogs, amphibians, animals)

    • Source

    • Rana chensinensis (Chinese brown frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • FTLKKSQLLLFFLGTINFSLCEEERNAEEERRDYPEEKDVEVEKR

    • Sequence Length

    • 45

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01187 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01187.

Physicochemical Information

    • Formula

    • C243H382N64O78S

    • Absent Amino Acids

    • HMW

    • Common Amino Acids

    • E

    • Mass

    • 5480.15

    • PI

    • 4.7

    • Basic Residues

    • 8

    • Acidic Residues

    • 12

    • Hydrophobic Residues

    • 14

    • Net Charge

    • -4

    • Boman Index

    • -139.85

    • Hydrophobicity

    • -0.916

    • Aliphatic Index

    • 75.78

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 1490

    • Absorbance 280nm

    • 33.86

    • Polar Residues

    • 9

DRAMP01187

DRAMP01187 chydropathy plot

Comments Information

    • Function

    • Has moderate antimicrobial activity against microorganisms.

Literature Information

  • ·Literature 1

    • Title

    • Molecular cloning of novel antimicrobial peptide genes from the skin of the Chinese brown frog, Rana chensinensis.

    • Reference

    • Zoolog Sci. 2011 Feb;28(2):112-117.

    • Author

    • Zhao J, Sun Y, Li Z, Su Q.