• DRAMP ID

    • DRAMP01219
    • Peptide Name

    • Palustrin-2LTa (Frogs, amphibians, animals)
    • Source

    • Hylarana latouchii (Broad-folded frog)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • SLWENFKNAGKQFILNILDKIRCRVAGGCRT
    • Sequence Length

    • 31
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus ATCC2592 (MIC=1.7 µM), Bacillus licheniformis X39 (MIC=14 µM), Psychrobacter faecalis X29 (MIC=1.7 µM).
    • Hemolytic Activity

      • [Ref.22426384] It has hemolytic activities (LD50=220μM) against human erythrocytes
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys23 and Cys29.
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01219 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01219.
    • Formula

    • C157H256N48O42S2
    • Absent Amino Acids

    • HMPY
    • Common Amino Acids

    • GIKLNR
    • Mass

    • 3552.18
    • PI

    • 9.84
    • Basic Residues

    • 6
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 12
    • Net Charge

    • +4
    • Boman Index

    • -57.52
    • Hydrophobicity

    • -0.21
    • Aliphatic Index

    • 91.29
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5625
    • Absorbance 280nm

    • 187.5
    • Polar Residues

    • 10

DRAMP01219

DRAMP01219 chydropathy plot
    • Function

    • Has antibacterial avctivity.
  • ·Literature 1
    • Title

    • Molecular cloning and characterization of antimicrobial peptides from skin of the broad-folded frog, Hylarana latouchii.
    • Reference

    • Biochimie. 2012 Jun;94(6):1317-1326.
    • Author

    • Wang H, Yu Z, Hu Y, Yu H, Ran R, Xia J, Wang D, Yang S, Yang X, Liu J.