General Information

    • DRAMP ID

    • DRAMP01225

    • Peptide Name

    • Palustrin-3AR (Frogs, amphibians, animals)

    • Source

    • Rana areolata (North American crawfish frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GIFPKIIGKGIVNGIKSLAKGVGMKVFKAGLNNIGNTGCNNRDEC

    • Sequence Length

    • 45

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • [Ref:12429503] HC50=200 µM against human erythrocytes

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Cyclization (Cys39 and Cys45)

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys39 and Cys45.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01225 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01225.

Physicochemical Information

    • Formula

    • C203H342N60O58S3

    • Absent Amino Acids

    • HQWY

    • Common Amino Acids

    • G

    • Mass

    • 4647.5

    • PI

    • 9.79

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +5

    • Boman Index

    • -35.13

    • Hydrophobicity

    • 0.016

    • Aliphatic Index

    • 93.11

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 2.84

    • Polar Residues

    • 19

DRAMP01225

DRAMP01225 chydropathy plot

Comments Information

    • This peptide could inhibit HIV infection at a concentration that is also toxic to T cells (J Virol 2005; 79

    • 11598-11606).

Literature Information

  • ·Literature 1

    • Title

    • Antimicrobial peptides and protease inhibitors in the skin secretions of the crawfish frog, Rana areolata.

    • Reference

    • Biochim Biophys Acta. 2002 Nov 19;1601(1):55-63.

    • Author

    • Ali MF, Lips KR, Knoop FC, Fritzsch B, Miller C, Conlon JM.