• DRAMP ID

    • DRAMP01235
    • Peptide Name

    • Palustrin-3b (Frogs, amphibians, animals)
    • Source

    • Rana palustris (Pickerel frog)
    • Family

    • Unknown
    • Gene

    • Unknown
    • Sequence

    • GIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLSNIGNTGCNEDEC
    • Sequence Length

    • 48
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial, Anti-Gram-, Antimicrobial
    • Target Organism

      • Gram-negative bacterium: Escherichia coli (MIC=1 µM).
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Unknown
    • Structure Description

    • Unknown
    • DRAMP01235 helical wheel diagram
    • Formula

    • C217H367N59O63S3
    • Absent Amino Acids

    • HQRWY
    • Common Amino Acids

    • G
    • Mass

    • 5745.38
    • PI

    • 10.06
    • Basic Residues

    • 7
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 16
    • Boman Index

    • -17.17
    • Hydrophobicity

    • 20.42
    • Aliphatic Index

    • 99.38
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 2.66
    • Polar Residues

    • 20

DRAMP01235

DRAMP01235 chydropathy plot
    • Tissue specificity

    • Expressed by the skin glands.
  • Literature 1
    • Reference

    • Biochim Biophys Acta. 2000 Nov 30;1543(1):95-105.
    • Author

    • Basir YJ, Knoop FC, Dulka J, Conlon JM.
    • Title

    • Multiple antimicrobial peptides and peptides related to bradykinin and neuromedin N isolated from skin secretions of the pickerel frog, Rana palustris.