General Information

    • DRAMP ID

    • DRAMP01236

    • Peptide Name

    • Palustrin-2CE (Frogs, amphibians, animals)

    • Source

    • Rana chensinensis (Chinese brown frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GLWDSIKNFGKTIALNVMDKIKCKIGGGCPP

    • Sequence Length

    • 31

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01236 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01236.

Physicochemical Information

    • Formula

    • C148H243N39O40S3

    • Absent Amino Acids

    • EHQRY

    • Common Amino Acids

    • GK

    • Mass

    • 3304.97

    • PI

    • 9.24

    • Basic Residues

    • 5

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +3

    • Boman Index

    • -14.15

    • Hydrophobicity

    • 0.007

    • Aliphatic Index

    • 88.06

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5625

    • Absorbance 280nm

    • 187.5

    • Polar Residues

    • 11

DRAMP01236

DRAMP01236 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Molecular cloning of novel antimicrobial peptide genes from the skin of the Chinese brown frog, Rana chensinensis.

    • Reference

    • Zoolog Sci. 2011 Feb;28(2):112-117.

    • Author

    • Zhao J, Sun Y, Li Z, Su Q.