• DRAMP ID

    • DRAMP01238
    • Peptide Name

    • Palustrin-2SIb (Frogs, amphibians, animals)
    • Source

    • Odorrana ishikawae
    • Family

    • Unknown
    • Gene

    • Unknown
    • Sequence

    • GLWNSIKIAGKKLFVNVLDKIRCKVAGGCKTSPDVE
    • Sequence Length

    • 36
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • Unknown
    • Biological Activity

    • Antibacterial, Anti-Gram+, Anti-Gram-, Antimicrobial
    • Target Organism

      • Gram-negative bacterium: Escherichia coli (MIC=6.3 µM);
      • Gram-positive bacteria: Staphylococcus aureus (MIC=6.3 µM), S. aureus (MRSA) (MIC=100 µM).
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Unknown
    • Structure Description

    • Unknown
    • DRAMP01238 helical wheel diagram
    • Formula

    • C174H292N48O48S2
    • Absent Amino Acids

    • HMQY
    • Common Amino Acids

    • K
    • Mass

    • 4513.14
    • PI

    • 10.14
    • Basic Residues

    • 7
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 14
    • Boman Index

    • -34.19
    • Hydrophobicity

    • 3.61
    • Aliphatic Index

    • 102.78
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5625
    • Absorbance 280nm

    • 160.71
    • Polar Residues

    • 11

DRAMP01238

DRAMP01238 chydropathy plot
    • No comments found on DRAMP database

  • Literature 1
    • Reference

    • Peptides. 2011 Oct;32(10):2052-2057.
    • Author

    • Iwakoshi-Ukena E, Okada G, Okimoto A, Fujii T, Sumida M, Ukena K.2011.
    • Title

    • Identification and structure-activity relationship of an antimicrobial peptide of the palustrin-2 family isolated from the skin of the endangered frog Odorrana ishikawae.