General Information

    • DRAMP ID

    • DRAMP01272

    • Peptide Name

    • Delta-ctenitoxin-Pn2a (Delta-CNTX-Pn2a; Neurotoxin Tx2-6; PnTx2-6)

    • Source

    • Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer)

    • Family

    • Belongs to the spider toxin Tx2 family

    • Gene

    • Not found

    • Sequence

    • ATCAGQDQPCKETCDCCGERGECVCGGPCICRQGYFWIAWYKLANCKK

    • Sequence Length

    • 48

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Insecticidal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • sodium channels

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01272 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01272.

Physicochemical Information

    • Formula

    • C222H340N64O67S10

    • Absent Amino Acids

    • HMS

    • Common Amino Acids

    • C

    • Mass

    • 5298.13

    • PI

    • 7.66

    • Basic Residues

    • 6

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +1

    • Boman Index

    • -6647

    • Hydrophobicity

    • -0.323

    • Aliphatic Index

    • 38.75

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 14605

    • Absorbance 280nm

    • 310.74

    • Polar Residues

    • 21

DRAMP01272

DRAMP01272 chydropathy plot

Comments Information

    • Function

    • Irreversible inhibitor of voltage-gated sodium channels (Nav). Binds voltage-dependently to sodium channels and inhibits the inactivation of the activated channelS. Also shifts the voltage dependence of the sodium conductance to negative potentials and decrease the peak inward current. Causes scratching, lacrimation, hypersalivation, sweating and agitation followed by spastic paralysis of the anterior and posterior extremities and death at dose levels of 0.79 mg/mouse. Is insecticidal to the larval and adult forms of the house fly. Enhances rat erectile function by increasing NO release in the cavernosum tissue.

Literature Information

  • ·Literature 1

    • Title

    • Electrophysiological characterization and molecular identification ofthe Phoneutria nigriventer peptide toxin PnTx2-6.

    • Reference

    • FEBS Lett. 523:219-223 (2002).

    • Author

    • Matavel A., Cruz J.S. , Penaforte C. L., Araujo D.A.M. , Kalapothakis E., Prado V.F., Diniz C. R., Cordeiro M. N., Beirao P.S. L.
  • ·Literature 2

    • Title

    • The purification and amino acid sequences of four Tx2 neurotoxinsfrom the venom of the Brazilian ‘armed' spider Phoneutria nigriventer (Keys).

    • Reference

    • FEBS Lett. 310:153-156 (1992).

    • Author

    • ;Cordeiro M. N., Diniz C. R., Valentim A.D.C. , von Eickstedt V.R.D., Gilroy J., Richardson M.
  • ·Literature 3

    • Title

    • Comparison of the partial proteomes of the venoms of Brazilianspiders of the genus Phoneutria.

    • Reference

    • Comp. BiocheM. Physiol. 142:173-187 (2006).

    • Author

    • Richardson M. , Pimenta A.M. , Bemquerer M. P., Santoro M. M. , Beirao P.S. , Lima M. E., Figueiredo S. G., Bloch C. Jr., Vasconcelos E.A., Campos F.A., Gomes P.C. , Cordeiro M. N.
  • ·Literature 4

    • Title

    • Structure and activity analysis of two spider toxins that altersodium channel inactivation kineticS.

    • Reference

    • Biochemistry 48:3078-3088 (2009).

    • Author

    • Matavel A., Fleury C. , Oliveira
  • ·Literature 5

    • Title

    • Tx2-6 toxin of the Phoneutria nigrive

    • Reference

    • Toxicon 51:1197-1206 (2008).

    • Author