General Information

    • DRAMP ID

    • DRAMP01296

    • Peptide Name

    • Omega-conotoxin-like protein 1 (OCLP1)

    • Source

    • Apis mellifera (Honeybee)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • ASKCGRHGDSCVSSSDCCPGTWCHTYANRCQVRITEEELMKQREKILGRKGKDY

    • Sequence Length

    • 54

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01296 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01296.

Physicochemical Information

    • Formula

    • C252H408N82O82S7

    • Absent Amino Acids

    • F

    • Common Amino Acids

    • CGKRS

    • Mass

    • 6122.93

    • PI

    • 8.63

    • Basic Residues

    • 12

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +5

    • Boman Index

    • -15934

    • Hydrophobicity

    • -0.946

    • Aliphatic Index

    • 43.33

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8855

    • Absorbance 280nm

    • 167.08

    • Polar Residues

    • 22

DRAMP01296

DRAMP01296 chydropathy plot

Comments Information

    • Function

    • The impact of this protein on the neuronal activity of the honeybee brain is not known. It does not affect apparent movement or hatching of blowfly larvae. However, when injected into fish, it induces a strong reversible paralytic effect. In addition, the presence of this small peptide in the hemolymph of adult drones together with its induction after bacterial infection suggests that this peptide exhibits antibacterial activity. This peptide may act by inhibiting ion channelS.

Literature Information

  • ·Literature 1

    • Title

    • Novel families of toxin-like peptides in insects and mammals: acomputational approach.

    • Reference

    • J. Mol. Biol. 369:553-566 (2007).

    • Author

    • Kaplan N., Morpurgo N., Linial M.
  • ·Literature 2

    • Title

    • Honey bee drones maintain humoral immune competence throughout alllife stages in the absence of vitellogenin production.

    • Reference

    • J. Exp. Biol. 215:1313-1322 (2012).

    • Author

    • Gatschenberger H., Gimple O., Tautz J., Beier H.