General Information

    • DRAMP ID

    • DRAMP01322

    • Peptide Name

    • Amolopin-n2 antimicrobial peptide (Frogs, amphibians, animals)

    • Source

    • Amolops loloensis (Rufous-spotted torrent frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • FTMKKSLLLLFFLGTINLSLCEQERNAEEERRDDLGERQAEVEKR

    • Sequence Length

    • 45

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01322 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01322.

Physicochemical Information

    • Formula

    • C232H381N67O74S2

    • Absent Amino Acids

    • HPWY

    • Common Amino Acids

    • EL

    • Mass

    • 5357.1

    • PI

    • 5

    • Basic Residues

    • 8

    • Acidic Residues

    • 10

    • Hydrophobic Residues

    • 15

    • Net Charge

    • -2

    • Boman Index

    • -133.08

    • Hydrophobicity

    • -0.7

    • Aliphatic Index

    • 88.89

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 9

DRAMP01322

DRAMP01322 chydropathy plot

Comments Information

    • Function

    • Amphibian defense peptide.

Literature Information

  • ·Literature 1

    • Title

    • cDNA Cloning of a Novel Antimicrobial Peptide from Amolops loloensis.

    • Reference

    • Submitted (APR-2008) to the EMBL/GenBank/DDBJ databases

    • Author

    • Wang A, Lai R.