• DRAMP ID

    • DRAMP01323
    • Peptide Name

    • Amolopin-2e antimicrobial peptide (Frogs, amphibians, animals)
    • Source

    • Amolops loloensis (Rufous-spotted torrent frog)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MFTMKKSLLLLFFLGTIHLSLCEQERNAEEERRDDLGERQAEVEKRFLPIAGKLLSGLSGLLGK
    • Sequence Length

    • 64
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01323 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01323.
    • Formula

    • C324H535N89O94S3
    • Absent Amino Acids

    • WY
    • Common Amino Acids

    • L
    • Mass

    • 7277.53
    • PI

    • 6.57
    • Basic Residues

    • 11
    • Acidic Residues

    • 10
    • Hydrophobic Residues

    • 24
    • Net Charge

    • +1
    • Boman Index

    • -103.66
    • Hydrophobicity

    • -0.156
    • Aliphatic Index

    • 106.72
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 0
    • Absorbance 280nm

    • 0
    • Polar Residues

    • 14

DRAMP01323

DRAMP01323 chydropathy plot
    • Function

    • Amphibian defense peptide.
  • ·Literature 1
    • Title

    • Five novel antimicrobial peptides from skin secretions of the frog, Amolops loloensis.
    • Reference

    • Comp Biochem Physiol B Biochem Mol Biol. 2010 Jan;155(1):72-76.
    • Author

    • Wang M, Wang Y, Wang A, Song Y, Ma D, Yang H, Ma Y, Lai R.