General Information

    • DRAMP ID

    • DRAMP01329

    • Peptide Name

    • Amolopin-5a antimicrobial peptide (Frogs, amphibians, animals)

    • Source

    • Amolops loloensis (Rufous-spotted torrent frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MFTMKKSLLLLFFLGAISLSLCEQERDADEEETEGGAKVETVKRASVPPGFTPFRVAPEIV

    • Sequence Length

    • 61

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01329 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01329.

Physicochemical Information

    • Formula

    • C303H485N75O91S3

    • Absent Amino Acids

    • HNWY

    • Common Amino Acids

    • EL

    • Mass

    • 6730.81

    • PI

    • 4.76

    • Basic Residues

    • 7

    • Acidic Residues

    • 10

    • Hydrophobic Residues

    • 24

    • Net Charge

    • -3

    • Boman Index

    • -70.13

    • Hydrophobicity

    • 0.071

    • Aliphatic Index

    • 89.51

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 13

DRAMP01329

DRAMP01329 chydropathy plot

Comments Information

    • Function

    • Amphibian defense peptide.

Literature Information

  • ·Literature 1

    • Title

    • cDNA Cloning of a Novel Antimicrobial Peptide From the Skin of Amolops loloensis.

    • Reference

    • Submitted (DEC-2007) to the EMBL/GenBank/DDBJ databases

    • Author

    • Wang A, Lai R.