General Information

    • DRAMP ID

    • DRAMP01332

    • Peptide Name

    • Amolopin-7a antimicrobial peptide (Frogs, amphibians, animals)

    • Source

    • Amolops loloensis (Rufous-spotted torrent frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MFTMKKSLLLLFFLGAISLSLCEQERDADEEDGGEVTEEEVKRAAFRGCWTKNYSPKPCLGKR

    • Sequence Length

    • 63

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01332 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01332.

Physicochemical Information

    • Formula

    • C316H502N84O96S5

    • Absent Amino Acids

    • H

    • Common Amino Acids

    • EL

    • Mass

    • 7174.27

    • PI

    • 5.36

    • Basic Residues

    • 10

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 20

    • Net Charge

    • -1

    • Boman Index

    • -120.16

    • Hydrophobicity

    • -0.422

    • Aliphatic Index

    • 71.27

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7115

    • Absorbance 280nm

    • 114.76

    • Polar Residues

    • 17

DRAMP01332

DRAMP01332 chydropathy plot

Comments Information

    • Function

    • Amphibian defense peptide.

Literature Information

  • ·Literature 1

    • Title

    • cDNA Cloning of a Novel Antimicrobial Peptide From the Skin of Amolops loloensis.

    • Reference

    • Submitted (DEC-2007) to the EMBL/GenBank/DDBJ databases

    • Author

    • Wang A, Lai R.