General Information

    • DRAMP ID

    • DRAMP01381

    • Peptide Name

    • Odorranain-K1 (OdK1; Frogs, amphibians, animals)

    • Source

    • Odorrana grahami (Yunnanfu frog) (Rana grahami)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GLFTLIKGAAKLIGKTVPKKQARLGMNLWLVKLPTNVKT

    • Sequence Length

    • 39

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-

    • Target Organism

      • [Ref.17272268] Gram-negative bacterium: Escherichia coli (MIC=4.68 μg/ml);
      • Gram-positive bacteria: Staphylococcus aureus (MIC=4.68 μg/ml), Bacillus subtilis (MIC=1.10 μg/ml).
      • Yeast: Candida albicans (MIC=1.10 μg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01381 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01381.

Physicochemical Information

    • Formula

    • C198H341N53O47S

    • Absent Amino Acids

    • CDEHSY

    • Common Amino Acids

    • KL

    • Mass

    • 4248.27

    • PI

    • 11.47

    • Basic Residues

    • 8

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +8

    • Boman Index

    • -9.62

    • Hydrophobicity

    • 0.192

    • Aliphatic Index

    • 120

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 144.74

    • Polar Residues

    • 10

DRAMP01381

DRAMP01381 chydropathy plot

Comments Information

    • Function

    • Odorranain-K1 exhibites antimicrobial activities against all of the tested microbes including Gram-positive and Gram-negative bacteria and fungi.

Literature Information

  • ·Literature 1

    • Title

    • Anti-infection peptidomics of amphibian skin.

    • Reference

    • Mol Cell Proteomics. 2007 May;6(5):882-894.

    • Author

    • Li J, Xu X, Xu C, Zhou W, Zhang K, Yu H, Zhang Y, Zheng Y, Rees HH, Lai R, Yang D, Wu J.