General Information

    • DRAMP ID

    • DRAMP01407

    • Peptide Name

    • Antimicrobial peptide odorranain B4 (Frogs, amphibians, animals)

    • Source

    • Rana grahami (Yunnanfu frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MFTLKKSLFVLFFLGIVSLSVCEHNRDADEEDGGEAIGGEVRRAALKGCWTKSIPPKPCSGKR

    • Sequence Length

    • 63

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01407 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01407.

Physicochemical Information

    • Formula

    • C306H491N85O88S4

    • Absent Amino Acids

    • QY

    • Common Amino Acids

    • GKL

    • Mass

    • 6897.02

    • PI

    • 8.57

    • Basic Residues

    • 11

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 22

    • Net Charge

    • +3

    • Boman Index

    • -91.93

    • Hydrophobicity

    • -0.144

    • Aliphatic Index

    • 80.48

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5625

    • Absorbance 280nm

    • 90.73

    • Polar Residues

    • 18

DRAMP01407

DRAMP01407 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • No title found on DRAMP

    • Reference

    • Submitted (APR-2008) to the EMBL/GenBank/DDBJ databases

    • Author

    • Ma Y, Li J.