General Information

    • DRAMP ID

    • DRAMP01446

    • Peptide Name

    • Proteinase inhibitor PSKP-1 (Frogs, amphibians, animals)

    • Source

    • Phyllomedusa sauvagei (Sauvage's leaf frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • VIEPKCYKYEGKKCPPDINPVCGTDKRTYYNECALCVFIRQSTKKADKAIKIKKWGKC

    • Sequence Length

    • 58

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli (EC50=3 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01446 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01446.

Physicochemical Information

    • Formula

    • C299H482N80O82S6

    • Absent Amino Acids

    • HM

    • Common Amino Acids

    • K

    • Mass

    • 6701.96

    • PI

    • 9.34

    • Basic Residues

    • 14

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +8

    • Boman Index

    • -110.64

    • Hydrophobicity

    • -0.721

    • Aliphatic Index

    • 60.52

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 11835

    • Absorbance 280nm

    • 207.63

    • Polar Residues

    • 19

DRAMP01446

DRAMP01446 chydropathy plot

Comments Information

    • Function

    • Shows hemagglutinating activity, inhibits prolyl endopeptidase. May have a role in mucosal defense against microbes by interacting directly with their membranes.

Literature Information

  • ·Literature 1

    • Title

    • A Kazal prolyl endopeptidase inhibitor isolated from the skin of Phyllomedusa sauvagii.

    • Reference

    • Eur J Biochem. 2004 Jun;271(11):2117-2126.

    • Author

    • Gebhard L.G, Carrizo F.U, Stern A.L, Burgardt N.I, Faivovich J, Lavilla E, Ermacora M.R.