General Information

    • DRAMP ID

    • DRAMP01519

    • Peptide Name

    • Esculentin-2PRa (Frogs, amphibians, animals)

    • Source

    • Rana pretiosa (North American oregon spotted frog)

    • Family

    • Belongs to the frog skin active peptide family (Brevinin subfamily)

    • Gene

    • Not found

    • Sequence

    • GVFSFLKTGAKLLGSTLLKMAGKAGAEHLACKATNQC

    • Sequence Length

    • 37

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-negative bacterium: Escherichia coli;
      • Gram-positive bacterium: Staphylococcus aureus.
      • Yeast: Candida albicans.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Cyclization (Cys31 and Cys37)

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys31 and Cys37.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01519 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01519.

Physicochemical Information

    • Formula

    • C166H278N46O47S3

    • Absent Amino Acids

    • DIPRWY

    • Common Amino Acids

    • AL

    • Mass

    • 3766.49

    • PI

    • 9.6

    • Basic Residues

    • 6

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +5

    • Boman Index

    • -5.92

    • Hydrophobicity

    • 0.308

    • Aliphatic Index

    • 87.3

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 3.47

    • Polar Residues

    • 13

DRAMP01519

DRAMP01519 chydropathy plot

Comments Information

    • Function

    • Shows antibacterial activity against both Gram-positive and Gram-negative bacteria and against the fungus C. albicans.

Literature Information

  • ·Literature 1

    • Title

    • Host defense peptides in skin secretions of the Oregon spotted frog Ranapretiosa: implications for species resistance to chytridiomycosis.

    • Reference

    • Dev Comp Immunol. 2011 Jun;35(6):644-649.

    • Author

    • Conlon JM, Mechkarska M, Ahmed E, Coquet L, Jouenne T, Leprince J, Vaudry H, Hayes MP, Padgett-Flohr G.