General Information

    • DRAMP ID

    • DRAMP01521

    • Peptide Name

    • Rugosin-B (Frogs, amphibians, animals)

    • Source

    • Glandirana rugosa (Japanese wrinkled frog) (Rana rugosa)

    • Family

    • Belongs to the frog skin active peptide family (Brevinin subfamily)

    • Gene

    • Not found

    • Sequence

    • SLFSLIKAGAKFLGKNLLKQGAQYAACKVSKEC

    • Sequence Length

    • 33

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus 209P (MIC=6.25 µg/ml), Bacillus subtilis ATCC6633 (MIC=6.25 µg/ml), Micrococcus luteus ATCC9341 (MIC=1.56 µg/ml), Streptococcus pyogenes COOK (MIC=12.5 µg/ml);
      • Gram-negative bacteria: Escherichia coli NIHJ (MIC=12.5 µg/ml), Pseudomonas aeruginosa PAO-1 (MIC=100 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Cyclization (Cys27 and Cys33)

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys27 and Cys33.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01521 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01521.

Physicochemical Information

    • Formula

    • C159H264N42O43S2

    • Absent Amino Acids

    • DHMPRTW

    • Common Amino Acids

    • K

    • Mass

    • 3516.22

    • PI

    • 9.7

    • Basic Residues

    • 6

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +5

    • Boman Index

    • -14.22

    • Hydrophobicity

    • 0.152

    • Aliphatic Index

    • 94.85

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1615

    • Absorbance 280nm

    • 50.47

    • Polar Residues

    • 10

DRAMP01521

DRAMP01521 chydropathy plot

Comments Information

    • Function

    • Shows antibacterial activity against both Gram-negative and Gram-positive bacteria.

    • Tissue specificity

    • Expressed by the skin glands.

    • PTM

    • Contains one disulfide bond 27-33.

Literature Information

  • ·Literature 1

    • Title

    • Isolation and characterization of novel antimicrobial peptides, rugosins A, B and C, from the skin of the frog, Rana rugosa.

    • Reference

    • Biochem Biophys Res Commun. 1995 Jul 6;212(1):249-254.

    • Author

    • Suzuki S, Ohe Y, Kagegawa T, Tatemoto K.