General Information

    • DRAMP ID

    • DRAMP01522

    • Peptide Name

    • Rugosin-C (Frogs, amphibians, animals)

    • Source

    • Glandirana rugosa (Japanese wrinkled frog) (Rana rugosa)

    • Family

    • Belongs to the frog skin active peptide family (Brevinin subfamily)

    • Gene

    • Not found

    • Sequence

    • GILDSFKQFAKGVGKDLIKGAAQGVLSTMSCKLAKTC

    • Sequence Length

    • 37

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacterium: Staphylococcus aureus 209P.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01522 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01522.

Physicochemical Information

    • Formula

    • C168H285N45O49S3

    • Absent Amino Acids

    • EHNPRWY

    • Common Amino Acids

    • K

    • Mass

    • 3815.56

    • PI

    • 9.51

    • Basic Residues

    • 6

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +4

    • Boman Index

    • -16.75

    • Hydrophobicity

    • 0.246

    • Aliphatic Index

    • 89.73

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 3.47

    • Polar Residues

    • 12

DRAMP01522

DRAMP01522 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity against Gram-positive bacteria.

    • Tissue specificity

    • Expressed by the skin glands.

    • PTM

    • Contains one disulfide bond 31-37.

Literature Information

  • ·Literature 1

    • Title

    • Isolation and characterization of novel antimicrobial peptides, rugosins A, B and C, from the skin of the frog, Rana rugosa.

    • Reference

    • Biochem. Biophys. Res. Commun. 1995; 212: 249-254.

    • Author

    • Suzuki S, Ohe Y, Kagegawa T, Tatemoto K.