• DRAMP ID

    • DRAMP01561
    • Peptide Name

    • Caerin-2 (Venom antimicrobial peptide-10)
    • Source

    • Mesobuthus eupeus (Lesser Asian scorpion) (Buthus eupeus)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MEIKYLLTVFLVLLIVSDHCQAFLFSLIPSAISGLISAFKGKRRRDLNAQIDQFKNFRKRDAELEELLSKLPIY
    • Sequence Length

    • 74
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01561 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01561.
    • Formula

    • C397H640N102O105S2
    • Absent Amino Acids

    • W
    • Common Amino Acids

    • L
    • Mass

    • 8586.19
    • PI

    • 9.3
    • Basic Residues

    • 12
    • Acidic Residues

    • 8
    • Hydrophobic Residues

    • 34
    • Net Charge

    • +4
    • Boman Index

    • -84.87
    • Hydrophobicity

    • 0.23
    • Aliphatic Index

    • 123.92
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 2980
    • Absorbance 280nm

    • 40.82
    • Polar Residues

    • 14

DRAMP01561

DRAMP01561 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Scorpion venom gland caerin-like antibacterial peptide gene: inducible expression and RNA editing.
    • Reference

    • Submitted (SEP-2006) to the EMBL/GenBank/DDBJ databases.
    • Author

    • Zhu S, Gao B.
  • ·Literature 2
    • Title

    • Genomic organization of the MeVAMP-10, a venom antimicrobial peptide from Mesobuthus eupeus.
    • Reference

    • Submitted (FEB-2007) to the EMBL/GenBank/DDBJ databases.
    • Author

    • Zhu S, Gao B.