General Information

    • DRAMP ID

    • DRAMP01627

    • Peptide Name

    • Skin peptide tyrosine-tyrosine (Skin-PYY; SPYY; Frogs, amphibians, animals)

    • Source

    • Phyllomedusa bicolor (Two-colored leaf frog)

    • Family

    • Belongs to the NPY family

    • Gene

    • Not found

    • Sequence

    • YPPKPESPGEDASPEEMNKYLTALRHYINLVTRQRY

    • Sequence Length

    • 36

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-negative bacteria: Aeromonas caviae (MIC=40 µg/ml), Escherichia coli (MIC=10 µg/ml);
      • Gram-positive bacteria: Enterococcus faecalis (MIC=10 µg/ml), Nocardia brasiliensis (MIC=20 µg/ml).
      • Fungi: Cryptococcus neoformans (MIC=20 µg/ml), Candida albicans (MIC=15 µg/ml), Microsporum canis (MIC=10 µg/ml), Tricophyton rubrum (MIC=15 µg/ml), Arthroderma simii (MIC=10 µg/ml), Aspergillus fumigatus (MIC=80 µg/ml), Aspergillus niger (MIC>100 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Amidation

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01627 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C190H292N52O58S

    • Absent Amino Acids

    • CFW

    • Common Amino Acids

    • P

    • Mass

    • 4264.78

    • PI

    • 6.77

    • Basic Residues

    • 6

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +1

    • Boman Index

    • -97.17

    • Hydrophobicity

    • -1.208

    • Aliphatic Index

    • 56.94

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5960

    • Absorbance 280nm

    • 170.29

    • Polar Residues

    • 11

DRAMP01627

DRAMP01627 chydropathy plot

Comments Information

    • Function

    • Shows a broad spectrum of antibacterial activity against Gram-positive and Gram-negative bacteria, yeast and fungi.

    • Tissue specificity

    • Skin.

    • PTM

    • C-terminal amidation (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Skin peptide tyrosine-tyrosine, a member of the pancreatic polypeptide family: isolation, structure, synthesis, and endocrine activity.

    • Reference

    • Proc Natl Acad Sci U S A. 1994 Oct 25;91(22):10295-10299.

    • Author

    • Mor A, Chartrel N, Vaudry H, Nicolas P.
  • ·Literature 2

    • Title

    • Broad spectrum antibiotic activity of the skin-PYY.

    • Reference

    • FEBS Lett. 1996 Feb 19;380(3):237-240.

    • Author

    • Vouldoukis I, Shai Y, Nicolas P, Mor A.