General Information

    • DRAMP ID

    • DRAMP01633

    • Peptide Name

    • Dermaseptin S9 (Frogs, amphibians, animals)

    • Source

    • Phyllomedusa sauvagii (Painted-belly leaf frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • DEEKRENEDEENQEDDEQSEMRRGLRSKIWLWVLLMIWQESNKFKKM

    • Sequence Length

    • 47

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01633 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01633.

Physicochemical Information

    • Formula

    • C256H401N73O85S3

    • Absent Amino Acids

    • ACHPTY

    • Common Amino Acids

    • E

    • Mass

    • 5957.62

    • PI

    • 4.61

    • Basic Residues

    • 9

    • Acidic Residues

    • 14

    • Hydrophobic Residues

    • 11

    • Net Charge

    • -5

    • Boman Index

    • -185.63

    • Hydrophobicity

    • -1.619

    • Aliphatic Index

    • 55.96

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 16500

    • Absorbance 280nm

    • 358.7

    • Polar Residues

    • 7

DRAMP01633

DRAMP01633 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Not found

    • Reference

    • Not found

    • Author

    • Not found