General Information

    • DRAMP ID

    • DRAMP01635

    • Peptide Name

    • Preprodermaseptin S11 (Frogs, amphibians, animals)

    • Source

    • Phyllomedusa sauvagei (Sauvage's leaf frog)

    • Family

    • Not found

    • Gene

    • drsS11

    • Sequence

    • EEEKRENEDEEEQEDDEQSEEKRALWKTLLKGAGKVFGHVAKQFLGSQGQPES

    • Sequence Length

    • 53

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01635 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01635.

Physicochemical Information

    • Formula

    • C260H406N74O96

    • Absent Amino Acids

    • CIMY

    • Common Amino Acids

    • E

    • Mass

    • 6104.52

    • PI

    • 4.5

    • Basic Residues

    • 9

    • Acidic Residues

    • 16

    • Hydrophobic Residues

    • 12

    • Net Charge

    • -7

    • Boman Index

    • -183.42

    • Hydrophobicity

    • -1.615

    • Aliphatic Index

    • 46.04

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 105.77

    • Polar Residues

    • 10

DRAMP01635

DRAMP01635 chydropathy plot

Comments Information

    • Function

    • Defense response to bacterium

Literature Information

  • ·Literature 1

    • Title

    • A new structural motif of alpha-helical antimicrobial peptides with a nonamphipathic hydrophobic core and cationic termini.

    • Reference

    • Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases.

    • Author

    • Amiche M., Lequin O., Vanhoye D., Bruston F., Ladram A., Convert O., Nicolas P.