General Information

    • DRAMP ID

    • DRAMP01637

    • Peptide Name

    • Dermaseptin S13 (Frogs, amphibians, animals)

    • Source

    • Phyllomedusa sauvagei (Sauvage's leaf frog)

    • Family

    • Not found

    • Gene

    • drsS13

    • Sequence

    • DEEKRENEDEENQEDDEQSEMRRGLRSKIKEAAKTAGKMALGFVNDMAGEQ

    • Sequence Length

    • 51

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01637 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01637.

Physicochemical Information

    • Formula

    • C236H386N74O93S3

    • Absent Amino Acids

    • CHPWY

    • Common Amino Acids

    • E

    • Mass

    • 5844.28

    • PI

    • 4.45

    • Basic Residues

    • 9

    • Acidic Residues

    • 16

    • Hydrophobic Residues

    • 10

    • Net Charge

    • -7

    • Boman Index

    • -210.21

    • Hydrophobicity

    • -1.659

    • Aliphatic Index

    • 38.43

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 10

DRAMP01637

DRAMP01637 chydropathy plot

Comments Information

    • Function

    • Defense response to bacterium

Literature Information

  • ·Literature 1

    • Title

    • A new structural motif of alpha-helical antimicrobial peptides with a nonamphipathic hydrophobic core and cationic termini.

    • Reference

    • Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases.

    • Author

    • Amiche M., Lequin O., Vanhoye D., Bruston F., Ladram A., Convert O., Nicolas P.