General Information

    • DRAMP ID

    • DRAMP01638

    • Peptide Name

    • Dermaseptin-L1 (Frogs, amphibians, animals)

    • Source

    • Hylomantis lemur (Lemur leaf frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS

    • Sequence Length

    • 32

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-negative bacterium: Escherichia coli (MIC=8 µM).
      • Fungi: Batrachochytrium dendrobatidis (MIC>100 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • [Ref.17561225]Displayed cytotoxic against HepG2 cells(LC50=45μM)

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01638 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01638.

Physicochemical Information

    • Formula

    • C140H233N41O44

    • Absent Amino Acids

    • CFHMRY

    • Common Amino Acids

    • A

    • Mass

    • 3194.64

    • PI

    • 9.53

    • Basic Residues

    • 4

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +2

    • Boman Index

    • -24.94

    • Hydrophobicity

    • -0.191

    • Aliphatic Index

    • 88.75

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 177.42

    • Polar Residues

    • 9

DRAMP01638

DRAMP01638 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Peptides with differential cytolytic activity from skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae).

    • Reference

    • Toxicon. 2007 Sep 15;50(4):498-506.

    • Author

    • Conlon JM, Woodhams DC, Raza H, Coquet L, Leprince J, Jouenne T, Vaudry H, Rollins-Smith LA.